PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011071232.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family SBP
Protein Properties Length: 470aa    MW: 51291.3 Da    PI: 8.4873
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011071232.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.61e-39183259278
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     CqvegC+ dls+akeyhr+h+vC+ hsk+p+v+v gle+rfCqqCsrfh lsefDe+krsCrrrL +hn+rrrk+q+
  XP_011071232.1 183 CQVEGCNIDLSTAKEYHRKHRVCDSHSKCPKVVVGGLERRFCQQCSRFHGLSEFDEKKRSCRRRLCDHNARRRKPQQ 259
                     **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.6E-33175244IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.052180257IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.67E-37181262IPR004333Transcription factor, SBP-box
PfamPF031108.3E-30183256IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MSHFSEMDWN AKWDWENFVA FGSKPIESPK KLQLADWMLV DDGEIHTGSF NLSGCGGNSG  60
ASSSDGGHGS SAKSSISAST DSSTRDGMQT PNFMFSKFEG SSSNFGKKIE TKGAEIFATS  120
PAPEASIGSM EPLIGLKLGK RTYFENSGGG SNIKSTSFSV MPTPSPSTPK KTKSSGQNAP  180
VHCQVEGCNI DLSTAKEYHR KHRVCDSHSK CPKVVVGGLE RRFCQQCSRF HGLSEFDEKK  240
RSCRRRLCDH NARRRKPQQE TIQLSSTRLP SPFYGGTQQM SFLLNSSPLV HSRTPANSSW  300
DNPCNSKFTL TKGFPSKSNG DGGTDQQLHM PGIKLPHVIN MQIAGNGLLA SKNPTSEVPN  360
PGSKGSLISS LDAAPEYRRA LSLLSSNSWD SCEPVSIPLH QPMHENGSSI NQPMIHMIPE  420
GVPLSSSEFW LSGQHSTYSR VQSLATNSNF QEIQLFKTPY DADFYSNMLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-29174256284squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1238255KKRSCRRRLCDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071232.10.0PREDICTED: squamosa promoter-binding-like protein 3
TrEMBLA0A075FEU70.0A0A075FEU7_SALMI; SQUAM
STRINGVIT_01s0010g03710.t011e-156(Vitis vinifera)
STRINGPGSC0003DMT4000847341e-156(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41292444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.37e-60squamosa promoter binding protein-like 2